![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.0: automated matches [276195] (1 protein) not a true family |
![]() | Protein automated matches [276199] (4 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276202] (7 PDB entries) |
![]() | Domain d6yezf_: 6yez F: [393646] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezj_, d6yezn_, d6yezp_ automated match to d5l8rf_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yezf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yezf_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii idvplatglvfrgfswpiaayrellngelvakdv
Timeline for d6yezf_: