![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein automated matches [236563] (6 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries) |
![]() | Domain d6yacc_: 6yac C: [393645] Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_ automated match to d5l8rc_ complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yac (more details), 2.5 Å
SCOPe Domain Sequences for d6yacc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yacc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd flsvrvylwhettrsmglay
Timeline for d6yacc_: