Lineage for d6yacc_ (6yac C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556036Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries)
  8. 2556038Domain d6yacc_: 6yac C: [393645]
    Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yaca_, d6yacb_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_
    automated match to d5l8rc_
    complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yacc_

PDB Entry: 6yac (more details), 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6yacc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yacc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d6yacc_:

Click to download the PDB-style file with coordinates for d6yacc_.
(The format of our PDB-style files is described here.)

Timeline for d6yacc_: