Lineage for d6yeze1 (6yez E:66-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393514Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries)
  8. 2393518Domain d6yeze1: 6yez E:66-129 [393642]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_
    automated match to d4y28e_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yeze1

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (E:) PsaE

SCOPe Domain Sequences for d6yeze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yeze1 b.34.4.0 (E:66-129) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
eevk

SCOPe Domain Coordinates for d6yeze1:

Click to download the PDB-style file with coordinates for d6yeze1.
(The format of our PDB-style files is described here.)

Timeline for d6yeze1: