Lineage for d6yez1_ (6yez 1:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028483Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)
  8. 3028504Domain d6yez1_: 6yez 1: [393641]
    Other proteins in same PDB: d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezn_, d6yezp_
    automated match to d5l8r1_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yez1_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (1:) Lhca1

SCOPe Domain Sequences for d6yez1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yez1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea
lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk
ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla
dpwhntignvlip

SCOPe Domain Coordinates for d6yez1_:

Click to download the PDB-style file with coordinates for d6yez1_.
(The format of our PDB-style files is described here.)

Timeline for d6yez1_: