Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276208] (7 PDB entries) |
Domain d6yezd_: 6yez D: [393640] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_ automated match to d5l8rd_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yezd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yezd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn frsigknvspievkftgkqpydl
Timeline for d6yezd_: