Lineage for d6yezd_ (6yez D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611473Species Pea (Pisum sativum) [TaxId:3888] [276208] (7 PDB entries)
  8. 2611477Domain d6yezd_: 6yez D: [393640]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_
    automated match to d5l8rd_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezd_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d6yezd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
frsigknvspievkftgkqpydl

SCOPe Domain Coordinates for d6yezd_:

Click to download the PDB-style file with coordinates for d6yezd_.
(The format of our PDB-style files is described here.)

Timeline for d6yezd_: