SCOPe 2.08: Domain d6yezd_: 6yez D:

Lineage for d6yezd_ (6yez D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
   beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail

4. Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family)
   automatically mapped to Pfam PF02531

5. Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)

6. Protein automated matches [236562] (8 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)

8. Domain d6yezd_: 6yez D: [393640]
   Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezn_, d6yezp_
   automated match to d5l8rd_
   complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezd_

PDB Entry: 6yez, 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex

PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d6yezd_:

Sequence; same for both SEQRES and ATOM records:

>d6yezd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
frsigknvspievkftgkqpydl

Timeline for d6yezd_:

• d6yezd_ first appeared in SCOPe 2.07