![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) ![]() |
![]() | Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
![]() | Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries) |
![]() | Domain d1dqaa1: 1dqa A:587-703 [39364] Other proteins in same PDB: d1dqaa4, d1dqab4, d1dqac4, d1dqad4 complexed with coa, mah, nap |
PDB Entry: 1dqa (more details), 2 Å
SCOPe Domain Sequences for d1dqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqaa1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg
Timeline for d1dqaa1: