Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (22 species) not a true protein |
Species Mycolicibacterium smegmatis [TaxId:1772] [393597] (1 PDB entry) |
Domain d6y8ob_: 6y8o B: [393606] automated match to d5mmoa_ protein/DNA complex; complexed with act, edo, na, nov |
PDB Entry: 6y8o (more details), 1.6 Å
SCOPe Domain Sequences for d6y8ob_:
Sequence, based on SEQRES records: (download)
>d6y8ob_ d.122.1.0 (B:) automated matches {Mycolicibacterium smegmatis [TaxId: 1772]} tilegleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvev rddgrgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrlea tvlrdgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlqem aflnkgltieltderdgkhrvfhypg
>d6y8ob_ d.122.1.0 (B:) automated matches {Mycolicibacterium smegmatis [TaxId: 1772]} tilegleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvev rddgrgipvemhatgmptidvvmtqvgvsvvnalstrleatvlrdgyewfqyydrsvpgk lkqggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgkhr vfhypg
Timeline for d6y8ob_: