Lineage for d6y8oa_ (6y8o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974139Species Mycolicibacterium smegmatis [TaxId:1772] [393597] (1 PDB entry)
  8. 2974140Domain d6y8oa_: 6y8o A: [393598]
    automated match to d5mmoa_
    protein/DNA complex; complexed with act, edo, na, nov

Details for d6y8oa_

PDB Entry: 6y8o (more details), 1.6 Å

PDB Description: mycobacterium smegmatis gyrb 22kda atpase sub-domain in complex with novobiocin
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6y8oa_:

Sequence, based on SEQRES records: (download)

>d6y8oa_ d.122.1.0 (A:) automated matches {Mycolicibacterium smegmatis [TaxId: 1772]}
sitilegleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsv
evrddgrgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrl
eatvlrdgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlq
emaflnkgltieltderdgkhrvfhypg

Sequence, based on observed residues (ATOM records): (download)

>d6y8oa_ d.122.1.0 (A:) automated matches {Mycolicibacterium smegmatis [TaxId: 1772]}
sitilegleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsv
evrddgrgipvemhatgmptidvvmtqvgvsvvnalstrleatvlrdgyewfqyydrsvp
gklkqggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgk
hrvfhypg

SCOPe Domain Coordinates for d6y8oa_:

Click to download the PDB-style file with coordinates for d6y8oa_.
(The format of our PDB-style files is described here.)

Timeline for d6y8oa_: