Lineage for d1phza1 (1phz A:19-115)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (15 families) 
regulatory domain linked to a wide range of metabolic enzymes
Family d.58.18.3: Phenylalanine metabolism regulatory domain [55028] (2 proteins) Protein Phenylalanine hydroxylase N-terminal domain [55029] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [55030] (2 PDB entries) 
Domain d1phza1: 1phz A:19-115 [39358]
Other proteins in same PDB: d1phza2
complexed with fe
Details for d1phza1
PDB Entry: 1phz (more details), 2.2 Å
PDB Description: structure of phosphorylated phenylalanine hydroxylase
PDB Compounds: (A:) protein (phenylalanine hydroxylase)SCOPe Domain Sequences for d1phza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqetsyiednsnqngaislifslkeevgalakvlrlfeendinlthiesrpsrlnkdeye
fftyldkrtkpvlgsiikslrndigatvhelsrdkek
SCOPe Domain Coordinates for d1phza1:
Click to download the PDB-style file with coordinates for d1phza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1phza1:
- d1phza1 first appeared (with stable ids) in SCOP 1.55
- d1phza1 appears in SCOPe 2.07
View in 3D
