SCOPe 2.08: Domain d6y54n1: 6y54 N:1-112

Lineage for d6y54n1 (6y54 N:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d6y54n1: 6y54 N:1-112 [393574]
   Other proteins in same PDB: d6y54h2, d6y54l2, d6y54m2, d6y54n2, d6y54o2, d6y54p_
   automated match to d1t66c1
   complexed with edo, iod, oa8, oab, oow

Details for d6y54n1

PDB Entry: 6y54, 2.67 Å

PDB Description: crystal structure of a neisseria meningitidis serogroup a capsular oligosaccharide bound to a functional fab

PDB Compounds: (N:) Fab A1.1 L chain

SCOPe Domain Sequences for d6y54n1:

Sequence; same for both SEQRES and ATOM records:

>d6y54n1 b.1.1.1 (N:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqsliysngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqnthipytfgggtkleik

Timeline for d6y54n1:

• d6y54n1 first appeared in SCOPe 2.07