![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
![]() | Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) ![]() |
![]() | Family d.58.18.2: Allosteric threonine deaminase C-terminal domain [55025] (1 protein) |
![]() | Protein Allosteric threonine deaminase C-terminal domain [55026] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55027] (1 PDB entry) |
![]() | Domain d1tdj_3: 1tdj 424-514 [39357] Other proteins in same PDB: d1tdj_1 |
PDB Entry: 1tdj (more details), 2.8 Å
SCOP Domain Sequences for d1tdj_3:
Sequence, based on SEQRES records: (download)
>d1tdj_3 d.58.18.2 (424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli} ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafelgd hepdfetrlnelgydchdetnnpafrfflag
>d1tdj_3 d.58.18.2 (424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli} ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafeydc hdetnnpafrfflag
Timeline for d1tdj_3: