Lineage for d1tdja3 (1tdj A:424-514)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176307Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2176335Family d.58.18.2: Allosteric threonine deaminase C-terminal domain [55025] (1 protein)
    automatically mapped to Pfam PF00585
  6. 2176336Protein Allosteric threonine deaminase C-terminal domain [55026] (1 species)
    duplication: consists of two homologous domains
  7. 2176337Species Escherichia coli [TaxId:562] [55027] (1 PDB entry)
  8. 2176339Domain d1tdja3: 1tdj A:424-514 [39357]
    Other proteins in same PDB: d1tdja1
    CASP2
    complexed with plp

Details for d1tdja3

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli
PDB Compounds: (A:) biosynthetic threonine deaminase

SCOPe Domain Sequences for d1tdja3:

Sequence, based on SEQRES records: (download)

>d1tdja3 d.58.18.2 (A:424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafelgd
hepdfetrlnelgydchdetnnpafrfflag

Sequence, based on observed residues (ATOM records): (download)

>d1tdja3 d.58.18.2 (A:424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafeydc
hdetnnpafrfflag

SCOPe Domain Coordinates for d1tdja3:

Click to download the PDB-style file with coordinates for d1tdja3.
(The format of our PDB-style files is described here.)

Timeline for d1tdja3: