SCOPe 2.08: Domain d1tdja3: 1tdj A:424-514

Lineage for d1tdja3 (1tdj A:424-514)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.2: Allosteric threonine deaminase C-terminal domain [55025] (1 protein)
   automatically mapped to Pfam PF00585

6. Protein Allosteric threonine deaminase C-terminal domain [55026] (1 species)
   duplication: consists of two homologous domains

7. Species Escherichia coli [TaxId:562] [55027] (1 PDB entry)

8. Domain d1tdja3: 1tdj A:424-514 [39357]
   Other proteins in same PDB: d1tdja1
   CASP2
   complexed with plp

Details for d1tdja3

PDB Entry: 1tdj, 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli

PDB Compounds: (A:) biosynthetic threonine deaminase

SCOPe Domain Sequences for d1tdja3:

Sequence, based on SEQRES records:

>d1tdja3 d.58.18.2 (A:424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafelgd
hepdfetrlnelgydchdetnnpafrfflag

Sequence, based on observed residues (ATOM records):

>d1tdja3 d.58.18.2 (A:424-514) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
ggrpshplqerlysfefpespgallrflntlgtywnislfhyrshgtdygrvlaafeydc
hdetnnpafrfflag

Timeline for d1tdja3:

• d1tdja3 first appeared (with stable ids) in SCOP 1.55, called d1tdj_3
  
• d1tdja3 appears in SCOPe 2.07