Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Heteractis crispa [TaxId:175771] [393550] (1 PDB entry) |
Domain d6y1gd_: 6y1g D: [393563] automated match to d5exba_ complexed with edo |
PDB Entry: 6y1g (more details), 2.3 Å
SCOPe Domain Sequences for d6y1gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y1gd_ d.22.1.0 (D:) automated matches {Heteractis crispa [TaxId: 175771]} gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgt nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrrlichhytsyrskkavr altmpgfhftdirlqmlrkekdeyfelyeasvarysdlpeka
Timeline for d6y1gd_: