Lineage for d1tdja2 (1tdj A:336-423)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2560947Family d.58.18.2: Allosteric threonine deaminase C-terminal domain [55025] (1 protein)
    automatically mapped to Pfam PF00585
  6. 2560948Protein Allosteric threonine deaminase C-terminal domain [55026] (1 species)
    duplication: consists of two homologous domains
  7. 2560949Species Escherichia coli [TaxId:562] [55027] (1 PDB entry)
  8. 2560950Domain d1tdja2: 1tdj A:336-423 [39356]
    Other proteins in same PDB: d1tdja1
    CASP2
    complexed with plp

Details for d1tdja2

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli
PDB Compounds: (A:) biosynthetic threonine deaminase

SCOPe Domain Sequences for d1tdja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdja2 d.58.18.2 (A:336-423) Allosteric threonine deaminase C-terminal domain {Escherichia coli [TaxId: 562]}
qreallavtipeekgsflkfcqllggrsvtefnyrfadaknacifvgvrlsrgleerkei
lqmlndggysvvdlsddemaklhvrymv

SCOPe Domain Coordinates for d1tdja2:

Click to download the PDB-style file with coordinates for d1tdja2.
(The format of our PDB-style files is described here.)

Timeline for d1tdja2: