Lineage for d1tdj_2 (1tdj 336-423)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133965Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) (S)
  5. 133971Family d.58.18.2: Allosteric threonine deaminase C-terminal domain [55025] (1 protein)
  6. 133972Protein Allosteric threonine deaminase C-terminal domain [55026] (1 species)
  7. 133973Species Escherichia coli [TaxId:562] [55027] (1 PDB entry)
  8. 133974Domain d1tdj_2: 1tdj 336-423 [39356]
    Other proteins in same PDB: d1tdj_1

Details for d1tdj_2

PDB Entry: 1tdj (more details), 2.8 Å

PDB Description: threonine deaminase (biosynthetic) from e. coli

SCOP Domain Sequences for d1tdj_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdj_2 d.58.18.2 (336-423) Allosteric threonine deaminase C-terminal domain {Escherichia coli}
qreallavtipeekgsflkfcqllggrsvtefnyrfadaknacifvgvrlsrgleerkei
lqmlndggysvvdlsddemaklhvrymv

SCOP Domain Coordinates for d1tdj_2:

Click to download the PDB-style file with coordinates for d1tdj_2.
(The format of our PDB-style files is described here.)

Timeline for d1tdj_2: