![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
![]() | Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
![]() | Protein Tyrosine phosphatase [52790] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries) |
![]() | Domain d6y2wa_: 6y2w A: [393554] automated match to d1xwwa_ complexed with act; mutant |
PDB Entry: 6y2w (more details), 1.77 Å
SCOPe Domain Sequences for d6y2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y2wa_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]} tksvlfvclgnkcrspiaeavfrklvtdqnisenwvidsgavsdwnvgrspdpravsclr nhgihtahkarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqkq liiedpyygndsdfetvyqqcvrccraflekah
Timeline for d6y2wa_: