Lineage for d1psdb3 (1psd B:327-410)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257846Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) (S)
  5. 257847Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 257848Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (1 species)
  7. 257849Species Escherichia coli [TaxId:562] [55024] (1 PDB entry)
  8. 257851Domain d1psdb3: 1psd B:327-410 [39355]
    Other proteins in same PDB: d1psda1, d1psda2, d1psdb1, d1psdb2
    complexed with nad

Details for d1psdb3

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1psdb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psdb3 d.58.18.1 (B:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOP Domain Coordinates for d1psdb3:

Click to download the PDB-style file with coordinates for d1psdb3.
(The format of our PDB-style files is described here.)

Timeline for d1psdb3: