![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
![]() | Superfamily d.58.18: Regulatory domain in the aminoacid metabolism [55021] (3 families) ![]() |
![]() | Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
![]() | Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55024] (1 PDB entry) |
![]() | Domain d1psdb3: 1psd B:327-410 [39355] Other proteins in same PDB: d1psda1, d1psda2, d1psdb1, d1psdb2 |
PDB Entry: 1psd (more details), 2.75 Å
SCOP Domain Sequences for d1psdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psdb3 d.58.18.1 (B:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli} fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead edvaekalqamkaipgtirarlly
Timeline for d1psdb3: