Lineage for d1psda3 (1psd A:327-410)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653844Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1653845Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 1653846Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 1653847Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 1653856Domain d1psda3: 1psd A:327-410 [39354]
    Other proteins in same PDB: d1psda1, d1psda2, d1psdb1, d1psdb2
    complexed with nad, ser

Details for d1psda3

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase
PDB Compounds: (A:) d-3-phosphoglycerate dehydrogenase (phosphoglycerate dehydrogenase)

SCOPe Domain Sequences for d1psda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psda3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOPe Domain Coordinates for d1psda3:

Click to download the PDB-style file with coordinates for d1psda3.
(The format of our PDB-style files is described here.)

Timeline for d1psda3: