SCOP 1.67: Domain d1qupb2: 1qup B:5-73

Lineage for d1qupb2 (1qup B:5-73)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)

6. Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries)

8. Domain d1qupb2: 1qup B:5-73 [39353]
   Other proteins in same PDB: d1qupa1, d1qupb1

Details for d1qupb2

PDB Entry: 1qup, 1.8 Å

PDB Description: crystal structure of the copper chaperone for superoxide dismutase

SCOP Domain Sequences for d1qupb2:

Sequence; same for both SEQRES and ATOM records:

>d1qupb2 d.58.17.1 (B:5-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
dtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintlrnc
gkdaiirga

Timeline for d1qupb2:

• d1qupb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qupb2 appears in SCOP 1.65
  
• d1qupb2 appears in SCOP 1.69
  
• d1qupb2 appears in the current release, SCOPe 2.08