Lineage for d1qupa2 (1qup A:2-73)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412789Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) (S)
  5. 412790Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)
  6. 412812Protein Copper chaperone for superoxide dismutase, N-terminal domain [55019] (1 species)
  7. 412813Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55020] (2 PDB entries)
  8. 412814Domain d1qupa2: 1qup A:2-73 [39352]
    Other proteins in same PDB: d1qupa1, d1qupb1

Details for d1qupa2

PDB Entry: 1qup (more details), 1.8 Å

PDB Description: crystal structure of the copper chaperone for superoxide dismutase

SCOP Domain Sequences for d1qupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
rncgkdaiirga

SCOP Domain Coordinates for d1qupa2:

Click to download the PDB-style file with coordinates for d1qupa2.
(The format of our PDB-style files is described here.)

Timeline for d1qupa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qupa1