Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein Copper chaperone [55017] (3 species) |
Species Enterococcus hirae [TaxId:1354] [55018] (1 PDB entry) |
Domain d1cpza_: 1cpz A: [39351] |
PDB Entry: 1cpz (more details)
SCOPe Domain Sequences for d1cpza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqaine lgyqaevi
Timeline for d1cpza_: