Lineage for d1cpza_ (1cpz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196902Protein Copper chaperone [55017] (3 species)
  7. 2196906Species Enterococcus hirae [TaxId:1354] [55018] (1 PDB entry)
  8. 2196907Domain d1cpza_: 1cpz A: [39351]

Details for d1cpza_

PDB Entry: 1cpz (more details)

PDB Description: copper chaperone of enterococcus hirae (apo-form)
PDB Compounds: (A:) protein (copz)

SCOPe Domain Sequences for d1cpza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]}
aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqaine
lgyqaevi

SCOPe Domain Coordinates for d1cpza_:

Click to download the PDB-style file with coordinates for d1cpza_.
(The format of our PDB-style files is described here.)

Timeline for d1cpza_: