Lineage for d1feeb_ (1fee B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80583Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 80584Family d.58.17.1: Metal-binding domain [55009] (6 proteins)
  6. 80585Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 80591Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (3 PDB entries)
  8. 80597Domain d1feeb_: 1fee B: [39350]

Details for d1feeb_

PDB Entry: 1fee (more details), 1.8 Å

PDB Description: crystal structure of copper-hah1

SCOP Domain Sequences for d1feeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feeb_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgl

SCOP Domain Coordinates for d1feeb_:

Click to download the PDB-style file with coordinates for d1feeb_.
(The format of our PDB-style files is described here.)

Timeline for d1feeb_: