Lineage for d1feea_ (1fee A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412789Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) (S)
  5. 412790Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)
  6. 412791Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 412797Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (3 PDB entries)
  8. 412802Domain d1feea_: 1fee A: [39349]

Details for d1feea_

PDB Entry: 1fee (more details), 1.8 Å

PDB Description: crystal structure of copper-hah1

SCOP Domain Sequences for d1feea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feea_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

SCOP Domain Coordinates for d1feea_:

Click to download the PDB-style file with coordinates for d1feea_.
(The format of our PDB-style files is described here.)

Timeline for d1feea_: