Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (3 PDB entries) |
Domain d1feea_: 1fee A: [39349] |
PDB Entry: 1fee (more details), 1.8 Å
SCOP Domain Sequences for d1feea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1feea_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1} pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt vsylgle
Timeline for d1feea_: