Lineage for d1fe4b_ (1fe4 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133926Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 133927Family d.58.17.1: Metal-binding domain [55009] (6 proteins)
  6. 133928Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 133934Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (3 PDB entries)
  8. 133938Domain d1fe4b_: 1fe4 B: [39348]

Details for d1fe4b_

PDB Entry: 1fe4 (more details), 1.75 Å

PDB Description: crystal structure of mercury-hah1

SCOP Domain Sequences for d1fe4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe4b_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

SCOP Domain Coordinates for d1fe4b_:

Click to download the PDB-style file with coordinates for d1fe4b_.
(The format of our PDB-style files is described here.)

Timeline for d1fe4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fe4a_