Lineage for d6xt2b1 (6xt2 B:1-163,B:340-374)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395105Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2395122Species Horse (Equus caballus) [TaxId:9796] [50138] (52 PDB entries)
    Uniprot P00327
  8. 2395175Domain d6xt2b1: 6xt2 B:1-163,B:340-374 [393473]
    Other proteins in same PDB: d6xt2a2, d6xt2b2, d6xt2c2, d6xt2d2
    automated match to d1heta1
    complexed with b7f, mrd, nai, zn

Details for d6xt2b1

PDB Entry: 6xt2 (more details), 1.55 Å

PDB Description: eqadh-nadh-heptafluorobutanol, p21
PDB Compounds: (B:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d6xt2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xt2b1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

SCOPe Domain Coordinates for d6xt2b1:

Click to download the PDB-style file with coordinates for d6xt2b1.
(The format of our PDB-style files is described here.)

Timeline for d6xt2b1: