SCOPe 2.08: Domain d6xrga_: 6xrg A:

Lineage for d6xrga_ (6xrg A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d6xrga_: 6xrg A: [393446]
   automated match to d3kf4a_

Details for d6xrga_

PDB Entry: 6xrg

PDB Description: abl 1b isoform inactive2 state

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d6xrga_:

Sequence; same for both SEQRES and ATOM records:

>d6xrga_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnydkwemertditmkhklgegqygevyegvwkkysltvavktlkedtmeveeflkeaa
vlkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmygdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkqgv

Timeline for d6xrga_:

• d6xrga_ first appeared in SCOPe 2.07