Lineage for d1cc7a_ (1cc7 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32910Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 32911Family d.58.17.1: Metal-binding domain [55009] (5 proteins)
  6. 32912Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 32913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (2 PDB entries)
  8. 32915Domain d1cc7a_: 1cc7 A: [39344]

Details for d1cc7a_

PDB Entry: 1cc7 (more details), 1.2 Å

PDB Description: crystal structure of the atx1 metallochaperone protein

SCOP Domain Sequences for d1cc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc7a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae)}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrsgkql

SCOP Domain Coordinates for d1cc7a_:

Click to download the PDB-style file with coordinates for d1cc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cc7a_: