Lineage for d1cc8a_ (1cc8 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417028Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1417029Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1417030Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 1417031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 1417032Domain d1cc8a_: 1cc8 A: [39343]
    complexed with ben, hg

Details for d1cc8a_

PDB Entry: 1cc8 (more details), 1.02 Å

PDB Description: crystal structure of the atx1 metallochaperone protein
PDB Compounds: (A:) protein (metallochaperone atx1)

SCOPe Domain Sequences for d1cc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrsgkql

SCOPe Domain Coordinates for d1cc8a_:

Click to download the PDB-style file with coordinates for d1cc8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cc8a_: