SCOPe 2.08: Domain d6xqpc1: 6xqp C:1-178

Lineage for d6xqpc1 (6xqp C:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6xqpc1: 6xqp C:1-178 [393429]
   Other proteins in same PDB: d6xqpb1, d6xqpb2, d6xqpc2, d6xqpd1, d6xqpd2, d6xqpe1, d6xqpe2, d6xqpf1, d6xqpf2, d6xqpg1, d6xqpg2, d6xqph1, d6xqph2
   automated match to d4l4va1
   complexed with 2lj, br, cl, gol, na

Details for d6xqpc1

PDB Entry: 6xqp, 2.9 Å

PDB Description: structure of human d462-e4 tcr in complex with human mr1-5-op-ru

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6xqpc1:

Sequence; same for both SEQRES and ATOM records:

>d6xqpc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d6xqpc1:

• d6xqpc1 first appeared in SCOPe 2.07