Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6xqpc1: 6xqp C:1-178 [393429] Other proteins in same PDB: d6xqpb1, d6xqpb2, d6xqpc2, d6xqpd1, d6xqpd2, d6xqpe1, d6xqpe2, d6xqpf1, d6xqpf2, d6xqpg1, d6xqpg2, d6xqph1, d6xqph2 automated match to d4l4va1 complexed with 2lj, br, cl, gol, na |
PDB Entry: 6xqp (more details), 2.9 Å
SCOPe Domain Sequences for d6xqpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xqpc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6xqpc1: