Lineage for d1aw0__ (1aw0 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32910Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 32911Family d.58.17.1: Metal-binding domain [55009] (5 proteins)
  6. 32930Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 32931Species Human (Homo sapiens) [TaxId:9606] [55013] (2 PDB entries)
  8. 32932Domain d1aw0__: 1aw0 - [39342]

Details for d1aw0__

PDB Entry: 1aw0 (more details)

PDB Description: fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures

SCOP Domain Sequences for d1aw0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw0__ d.58.17.1 (-) Menkes copper-transporting ATPase {Human (Homo sapiens)}
ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
iedmgfdatlsd

SCOP Domain Coordinates for d1aw0__:

Click to download the PDB-style file with coordinates for d1aw0__.
(The format of our PDB-style files is described here.)

Timeline for d1aw0__: