Lineage for d2aw0__ (2aw0 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80583Superfamily d.58.17: Metal-binding domain [55008] (1 family) (S)
  5. 80584Family d.58.17.1: Metal-binding domain [55009] (6 proteins)
  6. 80611Protein Menkes copper-transporting ATPase [55012] (1 species)
  7. 80612Species Human (Homo sapiens) [TaxId:9606] [55013] (2 PDB entries)
  8. 80614Domain d2aw0__: 2aw0 - [39341]

Details for d2aw0__

PDB Entry: 2aw0 (more details)

PDB Description: fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures

SCOP Domain Sequences for d2aw0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw0__ d.58.17.1 (-) Menkes copper-transporting ATPase {Human (Homo sapiens)}
ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
iedmgfdatlsd

SCOP Domain Coordinates for d2aw0__:

Click to download the PDB-style file with coordinates for d2aw0__.
(The format of our PDB-style files is described here.)

Timeline for d2aw0__: