Lineage for d2aw0__ (2aw0 -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.17: Metal-binding domain [55008] (1 family) 
Family d.58.17.1: Metal-binding domain [55009] (5 proteins) 
Protein Menkes copper-transporting ATPase [55012] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55013] (2 PDB entries) 
Domain d2aw0__: 2aw0 - [39341]
Details for d2aw0__
PDB Entry: 2aw0 (more details)
PDB Description: fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures
SCOP Domain Sequences for d2aw0__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw0__ d.58.17.1 (-) Menkes copper-transporting ATPase {Human (Homo sapiens)}
ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga
iedmgfdatlsd
SCOP Domain Coordinates for d2aw0__:
Click to download the PDB-style file with coordinates for d2aw0__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aw0__:
- d2aw0__ appears in SCOP 1.57
- d2aw0__ appears in the current release, SCOPe 2.08, called d2aw0a_
View in 3D