![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein Menkes copper-transporting ATPase [55012] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55013] (7 PDB entries) |
![]() | Domain d2aw0a_: 2aw0 A: [39341] 4th metal-binding domain complexed with ag |
PDB Entry: 2aw0 (more details)
SCOPe Domain Sequences for d2aw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} ltqetvinidgmtcnscvqsiegviskkpgvksirvslansngtveydplltspetlrga iedmgfdatlsd
Timeline for d2aw0a_: