SCOPe 2.08: Domain d6xsva2: 6xsv A:382-476

Lineage for d6xsva2 (6xsv A:382-476)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [256308] (2 PDB entries)

8. Domain d6xsva2: 6xsv A:382-476 [393400]
   Other proteins in same PDB: d6xsva1
   automated match to d2taaa1
   complexed with ca, man, mes, nag, plm

Details for d6xsva2

PDB Entry: 6xsv, 1.65 Å

PDB Description: x-ray structure of a tetragonal crystal form of alpha amylase from aspergillus oryzae (tala-amylase) at 1.65 a resolution

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6xsva2:

Sequence; same for both SEQRES and ATOM records:

>d6xsva2 b.71.1.0 (A:382-476) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

Timeline for d6xsva2:

• d6xsva2 first appeared in SCOPe 2.07