Lineage for d1afia_ (1afi A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520807Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2520808Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 protein domains)
  6. 2520893Protein Mercuric ion binding protein MerP [55010] (2 species)
  7. 2520897Species Shigella flexneri [TaxId:623] [55011] (3 PDB entries)
  8. 2520899Domain d1afia_: 1afi A: [39339]

Details for d1afia_

PDB Entry: 1afi (more details)

PDB Description: structure of the reduced form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
PDB Compounds: (A:) merp

SCOPe Domain Sequences for d1afia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afia_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Shigella flexneri [TaxId: 623]}
atqtvtlavpgmtcaacpitvkkalskvegvskvdvgfekreavvtfddtkasvqkltka
tadagypssvkq

SCOPe Domain Coordinates for d1afia_:

Click to download the PDB-style file with coordinates for d1afia_.
(The format of our PDB-style files is described here.)

Timeline for d1afia_: