Lineage for d1afj__ (1afj -)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) 
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins) 
Protein Mercuric ion binding protein MerP [55010] (1 species) Species Shigella flexneri [TaxId:623] [55011] (3 PDB entries) 
Domain d1afj__: 1afj - [39338]
complexed with hg
Details for d1afj__
PDB Entry: 1afj (more details)
PDB Description: structure of the mercury-bound form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
SCOP Domain Sequences for d1afj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afj__ d.58.17.1 (-) Mercuric ion binding protein MerP {Shigella flexneri}
atqtvtlavpgmtcaacpitvkkalskvegvskvdvgfekreavvtfddtkasvqkltka
tadagypssvkq
SCOP Domain Coordinates for d1afj__:
Click to download the PDB-style file with coordinates for d1afj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1afj__:
- d1afj__ first appeared (with stable ids) in SCOP 1.55
- d1afj__ appears in SCOP 1.65
- d1afj__ appears in SCOP 1.69
- d1afj__ appears in the current release, SCOPe 2.08, called d1afja_
View in 3D