SCOPe 2.08: Domain d6x9fa2: 6x9f A:97-311

Lineage for d6x9fa2 (6x9f A:97-311)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.0: automated matches [254328] (1 protein)
   not a true family

6. Protein automated matches [254749] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [271624] (6 PDB entries)

8. Domain d6x9fa2: 6x9f A:97-311 [393364]
   Other proteins in same PDB: d6x9fa1, d6x9fa3, d6x9fb1, d6x9fb3, d6x9fc1, d6x9fc3, d6x9fd1, d6x9fd3, d6x9fe1, d6x9fe3, d6x9ff1, d6x9ff3, d6x9fg1, d6x9fg3, d6x9fh1, d6x9fh3
   automated match to d4hv4a2
   complexed with cl, dms, edo, uxp

Details for d6x9fa2

PDB Entry: 6x9f, 2.35 Å

PDB Description: pseudomonas aeruginosa murc with az8074

PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6x9fa2:

Sequence; same for both SEQRES and ATOM records:

>d6x9fa2 c.72.2.0 (A:97-311) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raemlaelmryrhgiavagthgkttttsliasvfaaggldptfviggrlnaagtnaqlga
srylvaeadesdasflhlqpmvavvtnidadhmatyggdfnklkktfveflhnlpfygla
vmcvddpvvreilpqiarptvtyglsedadvrainirqegmrtwftvlrperepldvsvn
mpglhnvlnslativiatdegisdeaivqglsgfq

Timeline for d6x9fa2:

• d6x9fa2 first appeared in SCOPe 2.07