Lineage for d1fa0b1 (1fa0 B:352-530)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412771Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 412772Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 412773Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 412774Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (1 PDB entry)
  8. 412776Domain d1fa0b1: 1fa0 B:352-530 [39336]
    Other proteins in same PDB: d1fa0a3, d1fa0a4, d1fa0b3, d1fa0b4
    complexed with 3ad, 3at, mn, pop

Details for d1fa0b1

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp

SCOP Domain Sequences for d1fa0b1:

Sequence, based on SEQRES records: (download)

>d1fa0b1 d.58.16.1 (B:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

Sequence, based on observed residues (ATOM records): (download)

>d1fa0b1 d.58.16.1 (B:352-530) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtpkaylstmyigldfnkvdihipctefv
nlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps

SCOP Domain Coordinates for d1fa0b1:

Click to download the PDB-style file with coordinates for d1fa0b1.
(The format of our PDB-style files is described here.)

Timeline for d1fa0b1: