Lineage for d1fa0a1 (1fa0 A:352-523)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504982Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (2 families) (S)
  5. 504983Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
  6. 504984Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 504985Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (1 PDB entry)
  8. 504986Domain d1fa0a1: 1fa0 A:352-523 [39335]
    Other proteins in same PDB: d1fa0a3, d1fa0a4, d1fa0b3, d1fa0b4

Details for d1fa0a1

PDB Entry: 1fa0 (more details), 2.6 Å

PDB Description: structure of yeast poly(a) polymerase bound to manganate and 3'-datp

SCOP Domain Sequences for d1fa0a1:

Sequence, based on SEQRES records: (download)

>d1fa0a1 d.58.16.1 (A:352-523) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfd

Sequence, based on observed residues (ATOM records): (download)

>d1fa0a1 d.58.16.1 (A:352-523) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdklklvtdenkeeesikdapkaylstmyigldfnienkkekvdihi
pctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfd

SCOP Domain Coordinates for d1fa0a1:

Click to download the PDB-style file with coordinates for d1fa0a1.
(The format of our PDB-style files is described here.)

Timeline for d1fa0a1: