![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
![]() | Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
![]() | Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
![]() | Protein automated matches [254548] (7 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries) |
![]() | Domain d6x9nb1: 6x9n B:16-103 [393346] Other proteins in same PDB: d6x9na2, d6x9na3, d6x9nb2, d6x9nb3, d6x9nc2, d6x9nc3, d6x9nd2, d6x9nd3, d6x9ne2, d6x9ne3, d6x9nf2, d6x9nf3, d6x9ng2, d6x9ng3, d6x9nh2, d6x9nh3 automated match to d4hv4a1 complexed with cl, dms, edo, uyd, val |
PDB Entry: 6x9n (more details), 2.25 Å
SCOPe Domain Sequences for d6x9nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9nb1 c.5.1.0 (B:16-103) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga dvlvvssainranpevasalerripvvp
Timeline for d6x9nb1: