SCOP 1.73: Domain d1hnxj_: 1hnx J:

Lineage for d1hnxj_ (1hnx J:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (1 species)

7. Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)

8. Domain d1hnxj_: 1hnx J: [39334]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxj_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d1hnxj_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

Timeline for d1hnxj_:

• d1hnxj_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxj_ appears in SCOP 1.71
  
• d1hnxj_ appears in SCOP 1.75
  
• d1hnxj_ appears in the current release, SCOPe 2.08