Lineage for d1hr0j_ (1hr0 J:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) 
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) Protein Ribosomal protein S10 [55001] (1 species) Species Thermus thermophilus [TaxId:274] [55002] (6 PDB entries) 
Domain d1hr0j_: 1hr0 J: [39331]
Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
Details for d1hr0j_
PDB Entry: 1hr0 (more details), 3.2 Å
PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
SCOP Domain Sequences for d1hr0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
SCOP Domain Coordinates for d1hr0j_:
Click to download the PDB-style file with coordinates for d1hr0j_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hr0j_:
- d1hr0j_ appears in SCOP 1.57
- d1hr0j_ appears in the current release, SCOPe 2.08
View in 3D
