Lineage for d1fjgj_ (1fjg J:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604427Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 604428Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 604429Protein Ribosomal protein S10 [55001] (1 species)
  7. 604430Species Thermus thermophilus [TaxId:274] [55002] (18 PDB entries)
  8. 604431Domain d1fjgj_: 1fjg J: [39330]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgj_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1fjgj_:

Click to download the PDB-style file with coordinates for d1fjgj_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgj_: