Lineage for d6x9fd1 (6x9f D:9-96)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850409Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2850410Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2850433Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2850434Protein automated matches [254548] (7 species)
    not a true protein
  7. 2850454Species Pseudomonas aeruginosa [TaxId:208964] [334946] (3 PDB entries)
  8. 2850458Domain d6x9fd1: 6x9f D:9-96 [393298]
    Other proteins in same PDB: d6x9fa2, d6x9fa3, d6x9fb2, d6x9fb3, d6x9fc2, d6x9fc3, d6x9fd2, d6x9fd3, d6x9fe2, d6x9fe3, d6x9ff2, d6x9ff3, d6x9fg2, d6x9fg3, d6x9fh2, d6x9fh3
    automated match to d4hv4a1
    complexed with cl, dms, edo, uxp

Details for d6x9fd1

PDB Entry: 6x9f (more details), 2.35 Å

PDB Description: pseudomonas aeruginosa murc with az8074
PDB Compounds: (D:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6x9fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x9fd1 c.5.1.0 (D:9-96) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rrihfvgiggagmcgiaevllnlgyevsgsdlkasavterlekfgaqifighqaenadga
dvlvvssainranpevasalerripvvp

SCOPe Domain Coordinates for d6x9fd1:

Click to download the PDB-style file with coordinates for d6x9fd1.
(The format of our PDB-style files is described here.)

Timeline for d6x9fd1: