![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
![]() | Domain d1g1xf_: 1g1x F: [39328] Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_ |
PDB Entry: 1g1x (more details), 2.6 Å
SCOPe Domain Sequences for d1g1xf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1xf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
Timeline for d1g1xf_: