Lineage for d1g1xa_ (1g1x A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192565Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 192566Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 192567Protein Ribosomal protein S6 [54997] (1 species)
  7. 192568Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)
  8. 192586Domain d1g1xa_: 1g1x A: [39327]
    Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_

Details for d1g1xa_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna
PDB Compounds: (A:)

SCOP Domain Sequences for d1g1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1xa_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

SCOP Domain Coordinates for d1g1xa_:

Click to download the PDB-style file with coordinates for d1g1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xa_: