SCOPe 2.08: Domain d1g1xa_: 1g1x A:

Lineage for d1g1xa_ (1g1x A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1g1xa_: 1g1x A: [39327]
   Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_

Details for d1g1xa_

PDB Entry: 1g1x, 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

PDB Compounds: (A:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1g1xa_:

Sequence; same for both SEQRES and ATOM records:

>d1g1xa_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

Timeline for d1g1xa_:

• d1g1xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1xa_ appears in SCOPe 2.07