Lineage for d1g1xa_ (1g1x A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520582Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2520583Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2520584Protein Ribosomal protein S6 [54997] (4 species)
  7. 2520614Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2520670Domain d1g1xa_: 1g1x A: [39327]
    Other proteins in same PDB: d1g1xb_, d1g1xc_, d1g1xg_, d1g1xh_

Details for d1g1xa_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna
PDB Compounds: (A:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1g1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1xa_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

SCOPe Domain Coordinates for d1g1xa_:

Click to download the PDB-style file with coordinates for d1g1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xa_: