Lineage for d1qjha_ (1qjh A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80538Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 80539Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 80540Protein Ribosomal protein S6 [54997] (1 species)
  7. 80541Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)
  8. 80558Domain d1qjha_: 1qjh A: [39326]

Details for d1qjha_

PDB Entry: 1qjh (more details), 2.2 Å

PDB Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.

SCOP Domain Sequences for d1qjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjha_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvks

SCOP Domain Coordinates for d1qjha_:

Click to download the PDB-style file with coordinates for d1qjha_.
(The format of our PDB-style files is described here.)

Timeline for d1qjha_: